SCOPe 2.08: Domain d3fbec1: 3fbe C:2-131

Lineage for d3fbec1 (3fbe C:2-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3fbec1: 3fbe C:2-131 [175653]
   Other proteins in same PDB: d3fbea2, d3fbeb2, d3fbec2, d3fbed2, d3fbee2, d3fbef2
   automated match to d2b8pa1
   complexed with gdp, mg; mutant

Details for d3fbec1

PDB Entry: 3fbe, 2.4 Å

PDB Description: crystal structure of the mimivirus ndk n62l-r107g double mutant complexed with gdp

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3fbec1:

Sequence; same for both SEQRES and ATOM records:

>d3fbec1 d.58.6.1 (C:2-131) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandigenlihasdsedsav
deisiwfpet

Timeline for d3fbec1:

• d3fbec1 first appeared in SCOPe 2.01, called d3fbec_
  
• d3fbec1 appears in SCOPe 2.07