Lineage for d3fbec1 (3fbe C:2-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951328Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 2951405Domain d3fbec1: 3fbe C:2-131 [175653]
    Other proteins in same PDB: d3fbea2, d3fbeb2, d3fbec2, d3fbed2, d3fbee2, d3fbef2
    automated match to d2b8pa1
    complexed with gdp, mg; mutant

Details for d3fbec1

PDB Entry: 3fbe (more details), 2.4 Å

PDB Description: crystal structure of the mimivirus ndk n62l-r107g double mutant complexed with gdp
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3fbec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fbec1 d.58.6.1 (C:2-131) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandigenlihasdsedsav
deisiwfpet

SCOPe Domain Coordinates for d3fbec1:

Click to download the PDB-style file with coordinates for d3fbec1.
(The format of our PDB-style files is described here.)

Timeline for d3fbec1: