SCOPe 2.01: Domain d3fbdd_: 3fbd D:

Lineage for d3fbdd_ (3fbd D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein automated matches [190311] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187878] (8 PDB entries)

8. Domain d3fbdd_: 3fbd D: [175650]
   automated match to d1mz8b_
   protein/DNA complex; mutant

Details for d3fbdd_

PDB Entry: 3fbd, 2.9 Å

PDB Description: crystal structure of the nuclease domain of cole7(d493q mutant) in complex with an 18-bp duplex dna

PDB Compounds: (D:) Colicin-E7

SCOPe Domain Sequences for d3fbdd_:

Sequence; same for both SEQRES and ATOM records:

>d3fbdd_ d.4.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
krnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfqdfrkkfweevsk
dpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvt
pkrhidihrgk

Timeline for d3fbdd_:

• d3fbdd_ is new in SCOPe 2.01-stable
  
• d3fbdd_ appears in SCOPe 2.02
  
• d3fbdd_ appears in the current release, SCOPe 2.08