SCOPe 2.07: Domain d3fbda_: 3fbd A:

Lineage for d3fbda_ (3fbd A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 protein domains)

6. Protein automated matches [190311] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)

8. Domain d3fbda_: 3fbd A: [175649]
   automated match to d1mz8b_
   protein/DNA complex; mutant

Details for d3fbda_

PDB Entry: 3fbd, 2.9 Å

PDB Description: Crystal structure of the nuclease domain of COLE7(D493Q mutant) in complex with an 18-BP duplex DNA

PDB Compounds: (A:) Colicin-E7

SCOPe Domain Sequences for d3fbda_:

Sequence; same for both SEQRES and ATOM records:

>d3fbda_ d.4.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
skrnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfqdfrkkfweevs
kdpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvv
tpkrhidihrgk

Timeline for d3fbda_:

• d3fbda_ first appeared in SCOPe 2.01
  
• d3fbda_ appears in SCOPe 2.06