SCOPe 2.06: Domain d3fbbb1: 3fbb B:2-130

Lineage for d3fbbb1 (3fbb B:2-130)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3fbbb1: 3fbb B:2-130 [175638]
   Other proteins in same PDB: d3fbba2, d3fbbb2, d3fbbc2, d3fbbd2, d3fbbe2, d3fbbf2
   automated match to d2b8pa1
   complexed with mg, udp; mutant

Details for d3fbbb1

PDB Entry: 3fbb, 2.4 Å

PDB Description: crystal structure of the mimivirus ndk n62l-r107g double mutant complexed with udp

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3fbbb1:

Sequence; same for both SEQRES and ATOM records:

>d3fbbb1 d.58.6.1 (B:2-130) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandigenlihasdsedsav
deisiwfpe

Timeline for d3fbbb1:

• d3fbbb1 first appeared in SCOPe 2.01, called d3fbbb_
  
• d3fbbb1 was called d3fbbb_ in SCOPe 2.05
  
• d3fbbb1 appears in SCOPe 2.07
  
• d3fbbb1 appears in the current release, SCOPe 2.08