SCOPe 2.07: Domain d3fb5c_: 3fb5 C:

Lineage for d3fb5c_ (3fb5 C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries)

8. Domain d3fb5c_: 3fb5 C: [175636]
   Other proteins in same PDB: d3fb5a1, d3fb5a2, d3fb5a3, d3fb5b1, d3fb5b2
   automated match to d1k4cc_
   complexed with k

Details for d3fb5c_

PDB Entry: 3fb5, 2.8 Å

PDB Description: kcsa potassium channel in the partially open state with 14.5 a opening at t112

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d3fb5c_:

Sequence; same for both SEQRES and ATOM records:

>d3fb5c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
qwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlypv
tlwgrcvavvvmvagitsfglvtaalatwf

Timeline for d3fb5c_:

• d3fb5c_ first appeared in SCOPe 2.01
  
• d3fb5c_ appears in SCOPe 2.06
  
• d3fb5c_ appears in the current release, SCOPe 2.08