SCOPe 2.01: Domain d3fb5c_: 3fb5 C:

Lineage for d3fb5c_ (3fb5 C:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d3fb5c_: 3fb5 C: [175636]
   automated match to d1k4cc_
   complexed with k

Details for d3fb5c_

PDB Entry: 3fb5, 2.8 Å

PDB Description: KcsA potassium channel in the partially open state with 14.5 A opening at T112

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d3fb5c_:

Sequence; same for both SEQRES and ATOM records:

>d3fb5c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
qwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlypv
tlwgrcvavvvmvagitsfglvtaalatwf

Timeline for d3fb5c_:

• d3fb5c_ is new in SCOPe 2.01-stable
  
• d3fb5c_ appears in SCOPe 2.02
  
• d3fb5c_ appears in the current release, SCOPe 2.07