Lineage for d3fb5c_ (3fb5 C:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058900Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1058901Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 1058902Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1058919Protein Potassium channel protein [56901] (2 species)
  7. 1058920Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 1058940Domain d3fb5c_: 3fb5 C: [175636]
    automated match to d1k4cc_
    complexed with k

Details for d3fb5c_

PDB Entry: 3fb5 (more details), 2.8 Å

PDB Description: kcsa potassium channel in the partially open state with 14.5 a opening at t112
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d3fb5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fb5c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
qwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlypv
tlwgrcvavvvmvagitsfglvtaalatwf

SCOPe Domain Coordinates for d3fb5c_:

Click to download the PDB-style file with coordinates for d3fb5c_.
(The format of our PDB-style files is described here.)

Timeline for d3fb5c_: