![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (2 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
![]() | Domain d3fb5c_: 3fb5 C: [175636] automated match to d1k4cc_ complexed with k |
PDB Entry: 3fb5 (more details), 2.8 Å
SCOPe Domain Sequences for d3fb5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fb5c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} qwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlypv tlwgrcvavvvmvagitsfglvtaalatwf
Timeline for d3fb5c_: