Lineage for d1aqxb1 (1aqx B:77-209)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3768Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (30 PDB entries)
  8. 3815Domain d1aqxb1: 1aqx B:77-209 [17563]
    Other proteins in same PDB: d1aqxa2, d1aqxb2, d1aqxc2, d1aqxd2

Details for d1aqxb1

PDB Entry: 1aqx (more details), 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex

SCOP Domain Sequences for d1aqxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqxb1 a.45.1.1 (B:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d1aqxb1:

Click to download the PDB-style file with coordinates for d1aqxb1.
(The format of our PDB-style files is described here.)

Timeline for d1aqxb1: