SCOPe 2.06: Domain d3favd_: 3fav D:

Lineage for d3favd_ (3fav D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.3: EsxAB dimer-like [140453] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.3.1: ESAT-6 like [140454] (3 proteins)
   Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip

6. Protein ESAT-6, EsxA [140457] (1 species)
   6 kDa early secretory antigenic target

7. Species Mycobacterium tuberculosis [TaxId:1773] [140458] (2 PDB entries)
   Uniprot P0A564 1-94

8. Domain d3favd_: 3fav D: [175629]
   Other proteins in same PDB: d3fava_, d3favc_
   automated match to d1wa8b1
   complexed with imd, zn

Details for d3favd_

PDB Entry: 3fav, 2.15 Å

PDB Description: Structure of the CFP10-ESAT6 complex from Mycobacterium tuberculosis

PDB Compounds: (D:) 6 kDa early secretory antigenic target

SCOPe Domain Sequences for d3favd_:

Sequence; same for both SEQRES and ATOM records:

>d3favd_ a.25.3.1 (D:) ESAT-6, EsxA {Mycobacterium tuberculosis [TaxId: 1773]}
nfagieaaasaiqgnvtsihslldegkqsltklaaawggsgseayqgvqqkwdatateln
nalqnlartiseagqama

Timeline for d3favd_:

• d3favd_ first appeared in SCOPe 2.01
  
• d3favd_ appears in SCOPe 2.05
  
• d3favd_ appears in SCOPe 2.07
  
• d3favd_ appears in the current release, SCOPe 2.08