Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190140] (37 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries) |
Domain d3fatb1: 3fat B:2-259 [175620] Other proteins in same PDB: d3fata2, d3fatb2, d3fatc2 automated match to d1mm6a_ complexed with acy, amq, gol, so4 |
PDB Entry: 3fat (more details), 1.9 Å
SCOPe Domain Sequences for d3fatb1:
Sequence, based on SEQRES records: (download)
>d3fatb1 c.94.1.1 (B:2-259) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rtvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkyga rdadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpies aedlakqteiaygtldsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrk skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklse agvldklknkwwydkgec
>d3fatb1 c.94.1.1 (B:2-259) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rtvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkyga rdadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpies aedlakqteiaygtldsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrk skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklse agvldklknkwwydgec
Timeline for d3fatb1:
View in 3D Domains from other chains: (mouse over for more information) d3fata1, d3fata2, d3fatc1, d3fatc2 |