Lineage for d3fatb1 (3fat B:2-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145284Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (37 PDB entries)
  8. 2145297Domain d3fatb1: 3fat B:2-259 [175620]
    Other proteins in same PDB: d3fata2, d3fatb2, d3fatc2
    automated match to d1mm6a_
    complexed with acy, amq, gol, so4

Details for d3fatb1

PDB Entry: 3fat (more details), 1.9 Å

PDB Description: x-ray structure of iglur4 flip ligand-binding core (s1s2) in complex with (s)-ampa at 1.90a resolution
PDB Compounds: (B:) Glutamate receptor 4

SCOPe Domain Sequences for d3fatb1:

Sequence, based on SEQRES records: (download)

>d3fatb1 c.94.1.1 (B:2-259) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkyga
rdadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklse
agvldklknkwwydkgec

Sequence, based on observed residues (ATOM records): (download)

>d3fatb1 c.94.1.1 (B:2-259) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkyga
rdadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklse
agvldklknkwwydgec

SCOPe Domain Coordinates for d3fatb1:

Click to download the PDB-style file with coordinates for d3fatb1.
(The format of our PDB-style files is described here.)

Timeline for d3fatb1: