SCOPe 2.01: Domain d3fata_: 3fat A:

Lineage for d3fata_ (3fat A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein automated matches [190140] (10 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (15 PDB entries)

8. Domain d3fata_: 3fat A: [175619]
   automated match to d1mm6a_
   complexed with acy, amq, gol, so4

Details for d3fata_

PDB Entry: 3fat, 1.9 Å

PDB Description: x-ray structure of iglur4 flip ligand-binding core (s1s2) in complex with (s)-ampa at 1.90a resolution

PDB Compounds: (A:) Glutamate receptor 4

SCOPe Domain Sequences for d3fata_:

Sequence; same for both SEQRES and ATOM records:

>d3fata_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
grtvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkyg
ardadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlakqteiaygtldsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvr
kskgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlkls
eagvldklknkwwydkgec

Timeline for d3fata_:

• d3fata_ is new in SCOPe 2.01-stable
  
• d3fata_ appears in SCOPe 2.02
  
• d3fata_ appears in the current release, SCOPe 2.08, called d3fata1