SCOPe 2.08: Domain d3fasb1: 3fas B:2-260

Lineage for d3fasb1 (3fas B:2-260)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)

8. Domain d3fasb1: 3fas B:2-260 [175618]
   Other proteins in same PDB: d3fasa2, d3fasb2
   automated match to d1mm6a_
   complexed with glu, gol, so4

Details for d3fasb1

PDB Entry: 3fas, 1.4 Å

PDB Description: x-ray structure of iglur4 flip ligand-binding core (s1s2) in complex with (s)-glutamate at 1.40a resolution

PDB Compounds: (B:) Glutamate receptor 4

SCOPe Domain Sequences for d3fasb1:

Sequence; same for both SEQRES and ATOM records:

>d3fasb1 c.94.1.1 (B:2-260) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkyga
rdadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklse
agvldklknkwwydkgecg

Timeline for d3fasb1:

• d3fasb1 first appeared in SCOPe 2.01, called d3fasb_
  
• d3fasb1 appears in SCOPe 2.07