Lineage for d3faia_ (3fai A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224492Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1224493Protein Zn metallo-beta-lactamase [56283] (11 species)
  7. 1224494Species Aeromonas hydrophila, CphA [TaxId:644] [118144] (10 PDB entries)
    Uniprot P26918 28-252
  8. 1224499Domain d3faia_: 3fai A: [175614]
    automated match to d1x8ha_
    complexed with cl, gol, so4, zn; mutant

Details for d3faia_

PDB Entry: 3fai (more details), 1.7 Å

PDB Description: the di zinc carbapenemase cpha n220g mutant
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3faia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3faia_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]}
agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqs

SCOPe Domain Coordinates for d3faia_:

Click to download the PDB-style file with coordinates for d3faia_.
(The format of our PDB-style files is described here.)

Timeline for d3faia_: