SCOPe 2.07: Domain d3fa9b_: 3fa9 B:

Lineage for d3fa9b_ (3fa9 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (74 PDB entries)

8. Domain d3fa9b_: 3fa9 B: [175612]
   automated match to d1bm5a_
   complexed with act; mutant

Details for d3fa9b_

PDB Entry: 3fa9, 1.94 Å

PDB Description: crystal structure of the apo r132k:y134f:r111l:l121d mutant of cellular retinoic acid-binding protein ii at 1.94 angstrom resolution

PDB Compounds: (B:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d3fa9b_:

Sequence; same for both SEQRES and ATOM records:

>d3fa9b_ b.60.1.2 (B:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
dtmtaddvvctkvfvre

Timeline for d3fa9b_:

• d3fa9b_ first appeared in SCOPe 2.01
  
• d3fa9b_ appears in SCOPe 2.06
  
• d3fa9b_ appears in the current release, SCOPe 2.08