SCOPe 2.08: Domain d3fa0a_: 3fa0 A:

Lineage for d3fa0a_ (3fa0 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d3fa0a_: 3fa0 A: [175604]
   automated match to d1l17a_
   complexed with bme, cl, hed, k, po4; mutant

Details for d3fa0a_

PDB Entry: 3fa0, 1.09 Å

PDB Description: evaulaution at atomic resolution of the role of strain in destabilizing the temperature sensitive t4 lysozyme mutant arg96-- >his

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d3fa0a_:

Sequence; same for both SEQRES and ATOM records:

>d3fa0a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d3fa0a_:

• d3fa0a_ first appeared in SCOPe 2.01
  
• d3fa0a_ appears in SCOPe 2.07