![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188800] (1 PDB entry) |
![]() | Domain d3f9rb1: 3f9r B:2-246 [175603] Other proteins in same PDB: d3f9ra2, d3f9rb2 automated match to d2amya1 complexed with mg, so4 |
PDB Entry: 3f9r (more details), 1.85 Å
SCOPe Domain Sequences for d3f9rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f9rb1 c.108.1.0 (B:2-246) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} mkrvlllfdvdgtltpprlcqtdemralikrargagfcvgtvggsdfakqveqlgrdvlt qfdyvfaengllayrngleihrqsllnalgndrivkfvkktlrliadldipvqrgtfvey rngminvspigrncsqaerdefevydnehrvrasliaelensfpdfglkysiggqisfdv fpvgwdktyclqfveddfeeihffgdktqeggndyeiytdkrtighkvtsykdtiaevek iiamk
Timeline for d3f9rb1: