Lineage for d3f9ra_ (3f9r A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011283Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1011284Protein automated matches [190447] (20 species)
    not a true protein
  7. 1011360Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188800] (1 PDB entry)
  8. 1011361Domain d3f9ra_: 3f9r A: [175602]
    automated match to d2amya1
    complexed with mg, so4

Details for d3f9ra_

PDB Entry: 3f9r (more details), 1.85 Å

PDB Description: crystal structure of trypanosoma brucei phosphomannosemutase, tb.10.700.370
PDB Compounds: (A:) Phosphomannomutase

SCOPe Domain Sequences for d3f9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f9ra_ c.108.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gmkrvlllfdvdgtltpprlcqtdemralikrargagfcvgtvggsdfakqveqlgrdvl
tqfdyvfaengllayrngleihrqsllnalgndrivkfvkktlrliadldipvqrgtfve
yrngminvspigrncsqaerdefevydnehrvrasliaelensfpdfglkysiggqisfd
vfpvgwdktyclqfveddfeeihffgdktqeggndyeiytdkrtighkvtsykdtiaeve
kiiamk

SCOPe Domain Coordinates for d3f9ra_:

Click to download the PDB-style file with coordinates for d3f9ra_.
(The format of our PDB-style files is described here.)

Timeline for d3f9ra_: