Lineage for d3f9la_ (3f9l A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2496244Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2496250Protein Phage T4 lysozyme [53982] (1 species)
  7. 2496251Species Bacteriophage T4 [TaxId:10665] [53983] (572 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2496254Domain d3f9la_: 3f9l A: [175599]
    automated match to d1swya_
    complexed with cl, k, na, po4; mutant

Details for d3f9la_

PDB Entry: 3f9l (more details), 1.19 Å

PDB Description: evaulaution at atomic resolution of the role of strain in destabilizing the temperature sensitive t4 lysozyme mutant arg96-- >his
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d3f9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f9la_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvaaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d3f9la_:

Click to download the PDB-style file with coordinates for d3f9la_.
(The format of our PDB-style files is described here.)

Timeline for d3f9la_: