SCOPe 2.06: Domain d3f9hb_: 3f9h B:

Lineage for d3f9hb_ (3f9h B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (71 PDB entries)

8. Domain d3f9hb_: 3f9h B: [175596]
   automated match to d1uj1b_
   mutant

Details for d3f9hb_

PDB Entry: 3f9h, 2.9 Å

PDB Description: crystal structure of the f140a mutant of sars-coronovirus 3c-like protease at ph 7.6

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d3f9hb_:

Sequence; same for both SEQRES and ATOM records:

>d3f9hb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsalngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc

Timeline for d3f9hb_:

• d3f9hb_ first appeared in SCOPe 2.01
  
• d3f9hb_ appears in SCOPe 2.05
  
• d3f9hb_ appears in SCOPe 2.07
  
• d3f9hb_ appears in the current release, SCOPe 2.08