Lineage for d3f9gb_ (3f9g B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2057913Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 2057935Species SARS coronavirus [TaxId:227859] [89349] (71 PDB entries)
  8. 2058014Domain d3f9gb_: 3f9g B: [175594]
    automated match to d1q2wb_
    mutant

Details for d3f9gb_

PDB Entry: 3f9g (more details), 2.6 Å

PDB Description: Crystal Structure of the F140A mutant of SARS-Coronovirus 3C-like Protease at pH 6.5
PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d3f9gb_:

Sequence, based on SEQRES records: (download)

>d3f9gb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
frkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirks
nhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngsp
sgvyqcamrpnhtikgsalngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfy
gpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepl
tqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc

Sequence, based on observed residues (ATOM records): (download)

>d3f9gb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
frkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirks
nhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngsp
sgvyqcamrpnhtikgsascgsvgfnidydcvsfcymhhmelptgvhagtdlegkfygpf
vdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepltqd
hvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc

SCOPe Domain Coordinates for d3f9gb_:

Click to download the PDB-style file with coordinates for d3f9gb_.
(The format of our PDB-style files is described here.)

Timeline for d3f9gb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3f9ga_