Lineage for d3f90d_ (3f90 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838906Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 1838907Protein automated matches [190158] (18 species)
    not a true protein
  7. 1838919Species Desulfovibrio desulfuricans [TaxId:876] [188896] (3 PDB entries)
  8. 1838934Domain d3f90d_: 3f90 D: [175581]
    automated match to d1j9ea_
    complexed with fmn

Details for d3f90d_

PDB Entry: 3f90 (more details), 2.5 Å

PDB Description: desulfovibrio desulfuricans (atcc 29577) semiquinone flavodoxin
PDB Compounds: (D:) flavodoxin

SCOPe Domain Sequences for d3f90d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f90d_ c.23.5.0 (D:) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
skvlivfgsstgntesiaqkleeliaagghevtllnaadasaenladgydavlfgcsawg
medlemqddflslfeefdriglagrkvaafasgdqeyehfcgavpaieerakelgatiia
eglkmegdasndpeavasfaedvlkql

SCOPe Domain Coordinates for d3f90d_:

Click to download the PDB-style file with coordinates for d3f90d_.
(The format of our PDB-style files is described here.)

Timeline for d3f90d_: