SCOPe 2.01: Domain d3f8gb_: 3f8g B:

Lineage for d3f8gb_ (3f8g B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (6 PDB entries)

8. Domain d3f8gb_: 3f8g B: [175569]
   automated match to d1dzaa_
   complexed with so4

Details for d3f8gb_

PDB Entry: 3f8g, 2.6 Å

PDB Description: the x-ray structure of a dimeric variant of human pancreatic ribonuclease with high cytotoxic and antitumor activities

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3f8gb_:

Sequence; same for both SEQRES and ATOM records:

>d3f8gb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
kesrakkfqrqhmdsdsspsssstycnlmmccrkmtqgrckpvntfvheplvdvqnvcfq
ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacggspyvpvhf
dasve

Timeline for d3f8gb_:

• d3f8gb_ is new in SCOPe 2.01-stable
  
• d3f8gb_ appears in SCOPe 2.02
  
• d3f8gb_ appears in the current release, SCOPe 2.08