Lineage for d3f8bb_ (3f8b B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694846Species Lactococcus lactis [TaxId:416870] [188710] (8 PDB entries)
  8. 2694850Domain d3f8bb_: 3f8b B: [175566]
    automated match to d1xmab_

Details for d3f8bb_

PDB Entry: 3f8b (more details), 2 Å

PDB Description: Crystal structure of the multidrug binding transcriptional regulator LmrR in drug free state
PDB Compounds: (B:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d3f8bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f8bb_ a.4.5.0 (B:) automated matches {Lactococcus lactis [TaxId: 416870]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdesqggrrkyyrlteighenmrlafeswsrvdkiienlean

SCOPe Domain Coordinates for d3f8bb_:

Click to download the PDB-style file with coordinates for d3f8bb_.
(The format of our PDB-style files is described here.)

Timeline for d3f8bb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3f8ba_