Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
Protein automated matches [190696] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188122] (16 PDB entries) |
Domain d3f81b_: 3f81 B: [175560] automated match to d1vhra_ complexed with stt |
PDB Entry: 3f81 (more details), 1.9 Å
SCOPe Domain Sequences for d3f81b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f81b_ c.45.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsvqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegr sfmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhcre gysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp
Timeline for d3f81b_: