Lineage for d10gsa1 (10gs A:77-209)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443617Protein Class pi GST [81347] (3 species)
  7. 443618Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)
  8. 443684Domain d10gsa1: 10gs A:77-209 [17556]
    Other proteins in same PDB: d10gsa2, d10gsb2

Details for d10gsa1

PDB Entry: 10gs (more details), 2.2 Å

PDB Description: human glutathione s-transferase p1-1, complex with ter117

SCOP Domain Sequences for d10gsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d10gsa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d10gsa1:

Click to download the PDB-style file with coordinates for d10gsa1.
(The format of our PDB-style files is described here.)

Timeline for d10gsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d10gsa2