SCOPe 2.08: Domain d3f81a_: 3f81 A:

Lineage for d3f81a_ (3f81 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein automated matches [190696] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188122] (16 PDB entries)

8. Domain d3f81a_: 3f81 A: [175559]
   automated match to d1vhra_
   complexed with stt

Details for d3f81a_

PDB Entry: 3f81, 1.9 Å

PDB Description: interaction of vhr with sa3

PDB Compounds: (A:) dual specificity protein phosphatase 3

SCOPe Domain Sequences for d3f81a_:

Sequence; same for both SEQRES and ATOM records:

>d3f81a_ c.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsvqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegr
sfmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhcre
gysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp

Timeline for d3f81a_:

• d3f81a_ first appeared in SCOPe 2.01
  
• d3f81a_ appears in SCOPe 2.07