Lineage for d3f80a_ (3f80 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2873863Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2873884Protein Arginase [52770] (5 species)
  7. 2873916Species Human (Homo sapiens) [TaxId:9606] [142346] (33 PDB entries)
    Uniprot P05089 5-313
  8. 2873925Domain d3f80a_: 3f80 A: [175557]
    automated match to d1wvaa1
    complexed with 6hn, mn

Details for d3f80a_

PDB Entry: 3f80 (more details), 1.6 Å

PDB Description: (S)-2-amino-6-nitrohexanoic acid binds to human arginase I through multiple nitro-metal coordination interactions in the binuclear manganese cluster. Resolution 1.60 A.
PDB Compounds: (A:) Arginase-1

SCOPe Domain Sequences for d3f80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f80a_ c.42.1.1 (A:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyl

SCOPe Domain Coordinates for d3f80a_:

Click to download the PDB-style file with coordinates for d3f80a_.
(The format of our PDB-style files is described here.)

Timeline for d3f80a_: