![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species) CMGC group; GSK3 subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69824] (57 PDB entries) Uniprot P49841 35-383 ! Uniprot P49841 35-384 |
![]() | Domain d3f7zb1: 3f7z B:35-383 [175556] Other proteins in same PDB: d3f7za2, d3f7zb2 automated match to d1gngb_ complexed with 34o |
PDB Entry: 3f7z (more details), 2.4 Å
SCOPe Domain Sequences for d3f7zb1:
Sequence, based on SEQRES records: (download)
>d3f7zb1 d.144.1.7 (B:35-383) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
>d3f7zb1 d.144.1.7 (B:35-383) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk nrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvkl ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq iremnpnytpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelr dpnvklpngrdtpalfnfttqelssnpplatilipphar
Timeline for d3f7zb1: