Lineage for d3f7ma_ (3f7m A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873644Protein automated matches [190073] (16 species)
    not a true protein
  7. 2873772Species Lecanicillium psalliotae [TaxId:73499] [189114] (1 PDB entry)
  8. 2873773Domain d3f7ma_: 3f7m A: [175546]
    automated match to d1bjre_

Details for d3f7ma_

PDB Entry: 3f7m (more details), 1.6 Å

PDB Description: Crystal structure of apo Cuticle-Degrading Protease (ver112) from Verticillium psalliotae
PDB Compounds: (A:) Alkaline serine protease ver112

SCOPe Domain Sequences for d3f7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7ma_ c.41.1.1 (A:) automated matches {Lecanicillium psalliotae [TaxId: 73499]}
itqqqgatwgltrishrargstayaydtsagagacvyvidtgvedthpdfegrakqiksy
astardghghgthcagtigsktwgvakkvsifgvkvlddsgsgslsniiagmdfvasdrq
srncprrtvasmslgggysaalnqaaarlqssgvfvavaagndnrdaantspaseptvct
vgatdsndvrstfsnygrvvdifapgtsitstwiggrtntisgtsmatphiaglaaylfg
leggsagamcgriqtlstknvltsipsgtvnylafngat

SCOPe Domain Coordinates for d3f7ma_:

Click to download the PDB-style file with coordinates for d3f7ma_.
(The format of our PDB-style files is described here.)

Timeline for d3f7ma_: