SCOPe 2.06: Domain d3f7la_: 3f7l A:

Lineage for d3f7la_ (3f7l A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein automated matches [190916] (10 species)
   not a true protein

7. Species Alvinella pompejana [TaxId:6376] [188764] (2 PDB entries)

8. Domain d3f7la_: 3f7l A: [175545]
   automated match to d1cbja_
   complexed with acy, cu, cu1, na, so4, zn

Details for d3f7la_

PDB Entry: 3f7l, 0.99 Å

PDB Description: X-ray Crystal Structure of Alvinella pompejana Cu,Zn Superoxide Dismutase

PDB Compounds: (A:) Copper,Zinc Superoxide Dismutase

SCOPe Domain Sequences for d3f7la_:

Sequence; same for both SEQRES and ATOM records:

>d3f7la_ b.1.8.1 (A:) automated matches {Alvinella pompejana [TaxId: 6376]}
aihavcvlkgdspvtgtihlkeegdmvtvtgeitgltpgkhgfhvhefgdntngctsagg
hfnphgkehgapedenrhagdlgnvvagedgkavinmkdklvkltgpdsvigrtlvvhvd
eddlgrggheqskitgnaggrlacgvigitk

Timeline for d3f7la_:

• d3f7la_ first appeared in SCOPe 2.01
  
• d3f7la_ appears in SCOPe 2.05
  
• d3f7la_ appears in SCOPe 2.07
  
• d3f7la_ appears in the current release, SCOPe 2.08