Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein automated matches [190916] (10 species) not a true protein |
Species Alvinella pompejana [TaxId:6376] [188764] (2 PDB entries) |
Domain d3f7la_: 3f7l A: [175545] automated match to d1cbja_ complexed with acy, cu, cu1, na, so4, zn |
PDB Entry: 3f7l (more details), 0.99 Å
SCOPe Domain Sequences for d3f7la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f7la_ b.1.8.1 (A:) automated matches {Alvinella pompejana [TaxId: 6376]} aihavcvlkgdspvtgtihlkeegdmvtvtgeitgltpgkhgfhvhefgdntngctsagg hfnphgkehgapedenrhagdlgnvvagedgkavinmkdklvkltgpdsvigrtlvvhvd eddlgrggheqskitgnaggrlacgvigitk
Timeline for d3f7la_: