Lineage for d3f7la_ (3f7l A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2764372Protein automated matches [190916] (13 species)
    not a true protein
  7. 2764373Species Alvinella pompejana [TaxId:6376] [188764] (2 PDB entries)
  8. 2764374Domain d3f7la_: 3f7l A: [175545]
    automated match to d1cbja_
    complexed with acy, cu, cu1, na, so4, zn

Details for d3f7la_

PDB Entry: 3f7l (more details), 0.99 Å

PDB Description: X-ray Crystal Structure of Alvinella pompejana Cu,Zn Superoxide Dismutase
PDB Compounds: (A:) Copper,Zinc Superoxide Dismutase

SCOPe Domain Sequences for d3f7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7la_ b.1.8.1 (A:) automated matches {Alvinella pompejana [TaxId: 6376]}
aihavcvlkgdspvtgtihlkeegdmvtvtgeitgltpgkhgfhvhefgdntngctsagg
hfnphgkehgapedenrhagdlgnvvagedgkavinmkdklvkltgpdsvigrtlvvhvd
eddlgrggheqskitgnaggrlacgvigitk

SCOPe Domain Coordinates for d3f7la_:

Click to download the PDB-style file with coordinates for d3f7la_.
(The format of our PDB-style files is described here.)

Timeline for d3f7la_: