Lineage for d3f7ka_ (3f7k A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2373678Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2374335Protein automated matches [190916] (13 species)
    not a true protein
  7. 2374336Species Alvinella pompejana [TaxId:6376] [188764] (2 PDB entries)
  8. 2374338Domain d3f7ka_: 3f7k A: [175544]
    automated match to d1cbja_
    complexed with cu, cu1, na, peo, so4, zn

Details for d3f7ka_

PDB Entry: 3f7k (more details), 1.35 Å

PDB Description: X-ray Crystal Structure of an Alvinella pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex
PDB Compounds: (A:) Copper,Zinc Superoxide Dismutase

SCOPe Domain Sequences for d3f7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7ka_ b.1.8.1 (A:) automated matches {Alvinella pompejana [TaxId: 6376]}
aihavcvlkgdspvtgtihlkeegdmvtvtgeitgltpgkhgfhvhefgdntngctsagg
hfnphgkehgapedenrhagdlgnvvagedgkavinmkdklvkltgpdsvigrtlvvhvd
eddlgrggheqskitgnaggrlacgvigitk

SCOPe Domain Coordinates for d3f7ka_:

Click to download the PDB-style file with coordinates for d3f7ka_.
(The format of our PDB-style files is described here.)

Timeline for d3f7ka_: