| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein automated matches [190916] (13 species) not a true protein |
| Species Alvinella pompejana [TaxId:6376] [188764] (2 PDB entries) |
| Domain d3f7ka_: 3f7k A: [175544] automated match to d1cbja_ complexed with cu, cu1, na, peo, so4, zn |
PDB Entry: 3f7k (more details), 1.35 Å
SCOPe Domain Sequences for d3f7ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f7ka_ b.1.8.1 (A:) automated matches {Alvinella pompejana [TaxId: 6376]}
aihavcvlkgdspvtgtihlkeegdmvtvtgeitgltpgkhgfhvhefgdntngctsagg
hfnphgkehgapedenrhagdlgnvvagedgkavinmkdklvkltgpdsvigrtlvvhvd
eddlgrggheqskitgnaggrlacgvigitk
Timeline for d3f7ka_: