Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (17 species) not a true protein |
Species Toxoplasma gondii [TaxId:383379] [188681] (1 PDB entry) |
Domain d3f75a_: 3f75 A: [175538] automated match to d1fh0a_ complexed with br, cl, edo |
PDB Entry: 3f75 (more details), 1.99 Å
SCOPe Domain Sequences for d3f75a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f75a_ d.3.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 383379]} vlpselpagvdwrsrgcvtpvkdqrdcgscwafsttgalegahcaktgklvslseqelmd csraegnqscsggemndafqyvldsggicsedaypylardeecraqscekvvkilgfkdv prrseaamkaalakspvsiaieadqmpfqfyhegvfdascgtdldhgvllvgygtdkesk kdfwimknswgtgwgrdgymymamhkgeegqcgllldasfpvm
Timeline for d3f75a_: