Lineage for d3f75a_ (3f75 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889773Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1889774Protein automated matches [190230] (17 species)
    not a true protein
  7. 1889878Species Toxoplasma gondii [TaxId:383379] [188681] (1 PDB entry)
  8. 1889879Domain d3f75a_: 3f75 A: [175538]
    automated match to d1fh0a_
    complexed with br, cl, edo

Details for d3f75a_

PDB Entry: 3f75 (more details), 1.99 Å

PDB Description: activated toxoplasma gondii cathepsin l (tgcpl) in complex with its propeptide
PDB Compounds: (A:) Cathepsin L protease

SCOPe Domain Sequences for d3f75a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f75a_ d.3.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 383379]}
vlpselpagvdwrsrgcvtpvkdqrdcgscwafsttgalegahcaktgklvslseqelmd
csraegnqscsggemndafqyvldsggicsedaypylardeecraqscekvvkilgfkdv
prrseaamkaalakspvsiaieadqmpfqfyhegvfdascgtdldhgvllvgygtdkesk
kdfwimknswgtgwgrdgymymamhkgeegqcgllldasfpvm

SCOPe Domain Coordinates for d3f75a_:

Click to download the PDB-style file with coordinates for d3f75a_.
(The format of our PDB-style files is described here.)

Timeline for d3f75a_: