Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein automated matches [191027] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [188833] (5 PDB entries) |
Domain d3f72d_: 3f72 D: [175532] automated match to d1u2wa1 complexed with na; mutant |
PDB Entry: 3f72 (more details), 2.31 Å
SCOPe Domain Sequences for d3f72d_:
Sequence, based on SEQRES records: (download)
>d3f72d_ a.4.5.5 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]} fgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvt ianashhlrtlykqgvvnfrkegklalyslggeairqimmialahk
>d3f72d_ a.4.5.5 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]} fgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvt ianashhlrtlykqgvvnfrlyslggeairqimmialahk
Timeline for d3f72d_: