Lineage for d3f72b_ (3f72 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306548Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2306579Protein automated matches [191027] (2 species)
    not a true protein
  7. 2306580Species Staphylococcus aureus [TaxId:1280] [188833] (5 PDB entries)
  8. 2306585Domain d3f72b_: 3f72 B: [175530]
    automated match to d1u2wa1
    complexed with na; mutant

Details for d3f72b_

PDB Entry: 3f72 (more details), 2.31 Å

PDB Description: crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant
PDB Compounds: (B:) Cadmium efflux system accessory protein

SCOPe Domain Sequences for d3f72b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f72b_ a.4.5.5 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
fgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvt
ianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkke

SCOPe Domain Coordinates for d3f72b_:

Click to download the PDB-style file with coordinates for d3f72b_.
(The format of our PDB-style files is described here.)

Timeline for d3f72b_: