SCOPe 2.07: Domain d3f72b_: 3f72 B:

Lineage for d3f72b_ (3f72 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [191027] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [188833] (5 PDB entries)

8. Domain d3f72b_: 3f72 B: [175530]
   automated match to d1u2wa1
   complexed with na; mutant

Details for d3f72b_

PDB Entry: 3f72, 2.31 Å

PDB Description: crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant

PDB Compounds: (B:) Cadmium efflux system accessory protein

SCOPe Domain Sequences for d3f72b_:

Sequence; same for both SEQRES and ATOM records:

>d3f72b_ a.4.5.5 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
fgydeekvnriqgdlqtvdisgvsqilkaiadenrakityalcqdeelcvcdianilgvt
ianashhlrtlykqgvvnfrkegklalyslggeairqimmialahkke

Timeline for d3f72b_:

• d3f72b_ first appeared in SCOPe 2.01
  
• d3f72b_ appears in SCOPe 2.06
  
• d3f72b_ appears in the current release, SCOPe 2.08