SCOPe 2.06: Domain d3f71a_: 3f71 A:

Lineage for d3f71a_ (3f71 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein automated matches [190995] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188709] (1 PDB entry)

8. Domain d3f71a_: 3f71 A: [175528]
   automated match to d1pdwg_

Details for d3f71a_

PDB Entry: 3f71, 1.2 Å

PDB Description: crystal structure of e18d dj-1 with oxidized c106

PDB Compounds: (A:) Protein DJ-1

SCOPe Domain Sequences for d3f71a_:

Sequence; same for both SEQRES and ATOM records:

>d3f71a_ c.23.16.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemdtvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

Timeline for d3f71a_:

• d3f71a_ first appeared in SCOPe 2.01
  
• d3f71a_ appears in SCOPe 2.05
  
• d3f71a_ appears in SCOPe 2.07
  
• d3f71a_ appears in the current release, SCOPe 2.08