Lineage for d3f6sf_ (3f6s F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2856931Species Desulfovibrio desulfuricans [TaxId:876] [188896] (3 PDB entries)
  8. 2856948Domain d3f6sf_: 3f6s F: [175522]
    automated match to d1j9ea_
    complexed with fmn

Details for d3f6sf_

PDB Entry: 3f6s (more details), 2.5 Å

PDB Description: desulfovibrio desulfuricans (atcc 29577) oxidized flavodoxin alternate conformers
PDB Compounds: (F:) flavodoxin

SCOPe Domain Sequences for d3f6sf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f6sf_ c.23.5.0 (F:) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
skvlivfgsstgntesiaqkleeliaagghevtllnaadasaenladgydavlfgcsawg
medlemqddflslfeefdriglagrkvaafasgdqeyehfcgavpaieerakelgatiia
eglkmegdasndpeavasfaedvlkql

SCOPe Domain Coordinates for d3f6sf_:

Click to download the PDB-style file with coordinates for d3f6sf_.
(The format of our PDB-style files is described here.)

Timeline for d3f6sf_: