SCOPe 2.05: Domain d3f6rd_: 3f6r D:

Lineage for d3f6rd_ (3f6r D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (18 species)
   not a true protein

7. Species Desulfovibrio desulfuricans [TaxId:876] [188896] (3 PDB entries)

8. Domain d3f6rd_: 3f6r D: [175517]
   automated match to d1j9ea_
   complexed with fmn

Details for d3f6rd_

PDB Entry: 3f6r, 2 Å

PDB Description: desulfovibrio desulfuricans (atcc 29577) oxidized flavodoxin

PDB Compounds: (D:) flavodoxin

SCOPe Domain Sequences for d3f6rd_:

Sequence; same for both SEQRES and ATOM records:

>d3f6rd_ c.23.5.0 (D:) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
skvlivfgsstgntesiaqkleeliaagghevtllnaadasaenladgydavlfgcsawg
medlemqddflslfeefdriglagrkvaafasgdqeyehfcgavpaieerakelgatiia
eglkmegdasndpeavasfaedvlkql

Timeline for d3f6rd_:

• d3f6rd_ first appeared in SCOPe 2.01
  
• d3f6rd_ appears in SCOPe 2.04
  
• d3f6rd_ appears in SCOPe 2.06
  
• d3f6rd_ appears in the current release, SCOPe 2.08