| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein automated matches [190177] (9 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [189247] (1 PDB entry) |
| Domain d3f6pa_: 3f6p A: [175513] automated match to d1nxoa_ |
PDB Entry: 3f6p (more details), 1.95 Å
SCOPe Domain Sequences for d3f6pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f6pa_ c.23.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
mdkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkd
gvevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrq
Timeline for d3f6pa_: