SCOPe 2.06: Domain d3f5ua1: 3f5u A:2-277

Lineage for d3f5ua1 (3f5u A:2-277)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)

8. Domain d3f5ua1: 3f5u A:2-277 [175506]
   Other proteins in same PDB: d3f5ua2
   automated match to d1ig1a_
   complexed with anp, mg, so4

Details for d3f5ua1

PDB Entry: 3f5u, 2 Å

PDB Description: Crystal structure of the death associated protein kinase in complex with AMPPNP and Mg2+

PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d3f5ua1:

Sequence; same for both SEQRES and ATOM records:

>d3f5ua1 d.144.1.7 (A:2-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

Timeline for d3f5ua1:

• d3f5ua1 first appeared in SCOPe 2.01, called d3f5ua_
  
• d3f5ua1 was called d3f5ua_ in SCOPe 2.05
  
• d3f5ua1 appears in SCOPe 2.07
  
• d3f5ua1 appears in the current release, SCOPe 2.08