Lineage for d3f5ua1 (3f5u A:2-277)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (18 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (728 PDB entries)
  8. 2545335Domain d3f5ua1: 3f5u A:2-277 [175506]
    Other proteins in same PDB: d3f5ua2
    automated match to d1ig1a_
    complexed with anp, mg, so4

Details for d3f5ua1

PDB Entry: 3f5u (more details), 2 Å

PDB Description: Crystal structure of the death associated protein kinase in complex with AMPPNP and Mg2+
PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d3f5ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f5ua1 d.144.1.7 (A:2-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

SCOPe Domain Coordinates for d3f5ua1:

Click to download the PDB-style file with coordinates for d3f5ua1.
(The format of our PDB-style files is described here.)

Timeline for d3f5ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f5ua2