Lineage for d3f5pl1 (3f5p L:981-1285)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588271Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2588272Species Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries)
  8. 2588316Domain d3f5pl1: 3f5p L:981-1285 [175497]
    Other proteins in same PDB: d3f5pa2, d3f5pb2, d3f5pc2, d3f5pd2, d3f5pe2, d3f5pf2, d3f5pg2, d3f5ph2, d3f5pi2, d3f5pj2, d3f5pk2, d3f5pl2, d3f5pm2, d3f5pr2, d3f5ps2, d3f5pt2
    automated match to d1p4ob_
    complexed with 741

Details for d3f5pl1

PDB Entry: 3f5p (more details), 2.9 Å

PDB Description: complex structure of insulin-like growth factor receptor and 3- cyanoquinoline inhibitor
PDB Compounds: (L:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d3f5pl1:

Sequence, based on SEQRES records: (download)

>d3f5pl1 d.144.1.7 (L:981-1285) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
fsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaas
mrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemen
npvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdi
yetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneq
vlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfy
yseen

Sequence, based on observed residues (ATOM records): (download)

>d3f5pl1 d.144.1.7 (L:981-1285) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
fsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaas
mrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrppsls
kmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkgg
kgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmeggl
ldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseen

SCOPe Domain Coordinates for d3f5pl1:

Click to download the PDB-style file with coordinates for d3f5pl1.
(The format of our PDB-style files is described here.)

Timeline for d3f5pl1: