Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Insulin-like growth factor 1 receptor [69825] (1 species) PTK group; InsR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries) |
Domain d3f5pg1: 3f5p G:981-1285 [175492] Other proteins in same PDB: d3f5pa2, d3f5pb2, d3f5pc2, d3f5pd2, d3f5pe2, d3f5pf2, d3f5pg2, d3f5ph2, d3f5pi2, d3f5pj2, d3f5pk2, d3f5pl2, d3f5pm2, d3f5pr2, d3f5ps2, d3f5pt2 automated match to d1p4ob_ complexed with 741 |
PDB Entry: 3f5p (more details), 2.9 Å
SCOPe Domain Sequences for d3f5pg1:
Sequence, based on SEQRES records: (download)
>d3f5pg1 d.144.1.7 (G:981-1285) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} fsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaas mrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemen npvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdi yetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneq vlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfy yseen
>d3f5pg1 d.144.1.7 (G:981-1285) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} fsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaas mrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpepvl appslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetd yyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrf vmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyysee n
Timeline for d3f5pg1:
View in 3D Domains from other chains: (mouse over for more information) d3f5pa1, d3f5pa2, d3f5pb1, d3f5pb2, d3f5pc1, d3f5pc2, d3f5pd1, d3f5pd2, d3f5pe1, d3f5pe2, d3f5pf1, d3f5pf2, d3f5ph1, d3f5ph2, d3f5pi1, d3f5pi2, d3f5pj1, d3f5pj2, d3f5pk1, d3f5pk2, d3f5pl1, d3f5pl2, d3f5pm1, d3f5pm2, d3f5pr1, d3f5pr2, d3f5ps1, d3f5ps2, d3f5pt1, d3f5pt2 |