Lineage for d3f5oe_ (3f5o E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943965Protein automated matches [190102] (7 species)
    not a true protein
  7. 2944005Species Human (Homo sapiens) [TaxId:9606] [187682] (2 PDB entries)
  8. 2944010Domain d3f5oe_: 3f5o E: [175482]
    automated match to d2f0xa1
    complexed with cl, coa, p6g, uoc

Details for d3f5oe_

PDB Entry: 3f5o (more details), 1.7 Å

PDB Description: Crystal Structure of hTHEM2(undecan-2-one-CoA) complex
PDB Compounds: (E:) Thioesterase superfamily member 2

SCOPe Domain Sequences for d3f5oe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f5oe_ d.38.1.5 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglta
tlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdlt
nkatgkliaqgrhtkhlg

SCOPe Domain Coordinates for d3f5oe_:

Click to download the PDB-style file with coordinates for d3f5oe_.
(The format of our PDB-style files is described here.)

Timeline for d3f5oe_: