![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein automated matches [190102] (7 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187682] (2 PDB entries) |
![]() | Domain d3f5oc_: 3f5o C: [175480] automated match to d2f0xa1 complexed with cl, coa, p6g, uoc |
PDB Entry: 3f5o (more details), 1.7 Å
SCOPe Domain Sequences for d3f5oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f5oc_ d.38.1.5 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn katgkliaqgrhtkhlg
Timeline for d3f5oc_: