Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (293 PDB entries) |
Domain d3f5ga_: 3f5g A: [175477] automated match to d1ig1a_ complexed with adp, mg |
PDB Entry: 3f5g (more details), 1.85 Å
SCOPe Domain Sequences for d3f5ga_:
Sequence, based on SEQRES records: (download)
>d3f5ga_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqfe
>d3f5ga_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf sntsalakdfirrllvkdpkkrmtiqdslqhpwikppqfe
Timeline for d3f5ga_: