SCOPe 2.01: Domain d3f4wa_: 3f4w A:

Lineage for d3f4wa_ (3f4w A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (6 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189019] (2 PDB entries)

8. Domain d3f4wa_: 3f4w A: [175470]
   automated match to d1xbxa1
   complexed with mli

Details for d3f4wa_

PDB Entry: 3f4w, 1.65 Å

PDB Description: The 1.65A Crystal Structure of 3-hexulose-6-phosphate synthase from Salmonella typhimurium

PDB Compounds: (A:) Putative hexulose 6 phosphate synthase

SCOPe Domain Sequences for d3f4wa_:

Sequence; same for both SEQRES and ATOM records:

>d3f4wa_ c.1.2.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mklqlaldeltlpeamvfmdkvvddvdiievgtpfliregvnaikaikekyphkevlada
kimdgghfesqllfdagadyvtvlgvtdvltiqsciraakeagkqvvvdmicvddlparv
rlleeagadmlavhtgtdqqaagrkpiddlitmlkvrrkariavaggissqtvkdyallg
pdvvivgsaithaadpagearkisqvllqhh

Timeline for d3f4wa_:

• d3f4wa_ is new in SCOPe 2.01-stable
  
• d3f4wa_ appears in SCOPe 2.02
  
• d3f4wa_ appears in the current release, SCOPe 2.08