Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (6 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189019] (2 PDB entries) |
Domain d3f4wa_: 3f4w A: [175470] automated match to d1xbxa1 complexed with mli |
PDB Entry: 3f4w (more details), 1.65 Å
SCOPe Domain Sequences for d3f4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f4wa_ c.1.2.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} mklqlaldeltlpeamvfmdkvvddvdiievgtpfliregvnaikaikekyphkevlada kimdgghfesqllfdagadyvtvlgvtdvltiqsciraakeagkqvvvdmicvddlparv rlleeagadmlavhtgtdqqaagrkpiddlitmlkvrrkariavaggissqtvkdyallg pdvvivgsaithaadpagearkisqvllqhh
Timeline for d3f4wa_: