| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) ![]() |
| Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (2 proteins) automatically mapped to Pfam PF03740 |
| Protein automated matches [190984] (2 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [188678] (1 PDB entry) |
| Domain d3f4nh_: 3f4n H: [175469] Other proteins in same PDB: d3f4nc2 automated match to d1ho1a_ complexed with pxp, so4 |
PDB Entry: 3f4n (more details), 2.4 Å
SCOPe Domain Sequences for d3f4nh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f4nh_ c.1.24.1 (H:) automated matches {Yersinia pestis [TaxId: 632]}
dlllgvnidhiatlrnargtiypdpvqaafiaeqagadgitvhlredrrhitdrdvrilr
qtiqtrmnlemavtdemvdiacdikphfcclvpekrqevtteggldvagqvdkmtlavgr
ladvgilvslfidadfrqidaavaagapyieihtgayadastvlerqaelmriakaatya
agkglkvnaghgltyhnvqpiaalpemhelnighaiigqavmtglaaavtdmkvlmrear
r
Timeline for d3f4nh_: