Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) |
Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (2 proteins) automatically mapped to Pfam PF03740 |
Protein automated matches [190984] (2 species) not a true protein |
Species Yersinia pestis [TaxId:632] [188678] (1 PDB entry) |
Domain d3f4nb_: 3f4n B: [175463] Other proteins in same PDB: d3f4nc2 automated match to d1ho1a_ complexed with pxp, so4 |
PDB Entry: 3f4n (more details), 2.4 Å
SCOPe Domain Sequences for d3f4nb_:
Sequence, based on SEQRES records: (download)
>d3f4nb_ c.1.24.1 (B:) automated matches {Yersinia pestis [TaxId: 632]} adlllgvnidhiatlrnargtiypdpvqaafiaeqagadgitvhlredrrhitdrdvril rqtiqtrmnlemavtdemvdiacdikphfcclvpekrqevtteggldvagqvdkmtlavg rladvgilvslfidadfrqidaavaagapyieihtgayadastvlerqaelmriakaaty aagkglkvnaghgltyhnvqpiaalpemhelnighaiigqavmtglaaavtdmkvlmrea rr
>d3f4nb_ c.1.24.1 (B:) automated matches {Yersinia pestis [TaxId: 632]} adlllgvnidhiatlrnargtiypdpvqaafiaeqagadgitvhlredrrhitdrdvril rqtiqtrmnlemavtdemvdiacdikphfcclvpekrqeggldvagqvdkmtlavgrlad vgilvslfidadfrqidaavaagapyieihtgayadastvlerqaelmriakaatyaagk glkvnaghgltyhnvqpiaalpemhelnighaiigqavmtglaaavtdmkvlmrearr
Timeline for d3f4nb_: