SCOPe 2.01: Domain d3f49s_: 3f49 S:

Lineage for d3f49s_ (3f49 S:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein automated matches [190073] (9 species)
   not a true protein

7. Species Bacillus amyloliquefaciens [TaxId:1390] [186793] (2 PDB entries)

8. Domain d3f49s_: 3f49 S: [175451]
   automated match to d1gnva_
   complexed with na

Details for d3f49s_

PDB Entry: 3f49, 1.7 Å

PDB Description: anion-triggered engineered subtilisin subt_bacam

PDB Compounds: (S:) subtilisin bpn'

SCOPe Domain Sequences for d3f49s_:

Sequence; same for both SEQRES and ATOM records:

>d3f49s_ c.41.1.1 (S:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
akcvsygvaqikapalhsqgytgsnvkvavlasgidsshpdlnvaggasfvpsetnpfqd
nnshgthvagtvlavapsaslyavkvlgadgsgqaswiingiewaiannmdvinmslgsp
sgsaalkaavdkavasgvvvvaaagnsgtsgssstvsypakypsviavgavdssnqrapf
ssvgpeldvmapgvsicstlpggkygalsgtsmasphvagaaalilskhpnwtntqvrss
lentatklgdsfyygkglinveaaaq

Timeline for d3f49s_:

• d3f49s_ is new in SCOPe 2.01-stable
  
• d3f49s_ appears in SCOPe 2.02
  
• d3f49s_ appears in the current release, SCOPe 2.08