Lineage for d3f49s_ (3f49 S:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873644Protein automated matches [190073] (16 species)
    not a true protein
  7. 2873645Species Bacillus amyloliquefaciens [TaxId:1390] [186793] (5 PDB entries)
  8. 2873649Domain d3f49s_: 3f49 S: [175451]
    automated match to d1gnva_
    complexed with na

Details for d3f49s_

PDB Entry: 3f49 (more details), 1.7 Å

PDB Description: anion-triggered engineered subtilisin subt_bacam
PDB Compounds: (S:) Subtilisin BPN

SCOPe Domain Sequences for d3f49s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f49s_ c.41.1.1 (S:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
akcvsygvaqikapalhsqgytgsnvkvavlasgidsshpdlnvaggasfvpsetnpfqd
nnshgthvagtvlavapsaslyavkvlgadgsgqaswiingiewaiannmdvinmslgsp
sgsaalkaavdkavasgvvvvaaagnsgtsgssstvsypakypsviavgavdssnqrapf
ssvgpeldvmapgvsicstlpggkygalsgtsmasphvagaaalilskhpnwtntqvrss
lentatklgdsfyygkglinveaaaq

SCOPe Domain Coordinates for d3f49s_:

Click to download the PDB-style file with coordinates for d3f49s_.
(The format of our PDB-style files is described here.)

Timeline for d3f49s_: